PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12736.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 273aa    MW: 31240.8 Da    PI: 5.029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12736.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.9e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde l+++++ +G+  Wk ++r+  ++R++k+c++rw++yl
  mrna12736.1-v1.0-hybrid 14 RGVWSAEEDEALKRYIRTHGPCKWKEVSRRAELNRCPKSCRLRWRNYL 61
                             899********************************************7 PP

2Myb_DNA-binding461.2e-1467110144
                              TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrw 44 
                              rg+ +++E++l+++ +k+lG++ +W++Ia +++ gRt++++k++w
  mrna12736.1-v1.0-hybrid  67 RGNISEDEEDLILRMHKLLGNRyRWSLIAGRLP-GRTDNEIKNHW 110
                              7899*****************************.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.8965IPR017930Myb domain
SuperFamilySSF466891.83E-2712110IPR009057Homeodomain-like
SMARTSM007172.2E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-221668IPR009057Homeodomain-like
CDDcd001678.89E-121761No hitNo description
SMARTSM007174.6E-1266116IPR001005SANT/Myb domain
PROSITE profilePS5129415.1466118IPR017930Myb domain
PfamPF002491.0E-1267110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1869117IPR009057Homeodomain-like
CDDcd001671.42E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRKPCSNEN SVNRGVWSAE EDEALKRYIR THGPCKWKEV SRRAELNRCP KSCRLRWRNY  60
LRPGIKRGNI SEDEEDLILR MHKLLGNRYR WSLIAGRLPG RTDNEIKNHW ICNLSKRFLE  120
KAPPDNQIIK AHDNFHRPRG ESSNCNFKEV EDVSGTEDQE KAVPSKSTTI TENLPPSSSL  180
VVSDQLPEPK DSSATFLVDL EMYLNDHDLQ NSTDIDHDLH LAEWINLLSG DDGDLHQEEL  240
GTEFISFLAD GTQELQADWD QFMEEALLSS PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-221211825128MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288974.10.0PREDICTED: transcription factor WER-like
STRINGVIT_11s0016g01310.t015e-52(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-48myb domain protein 5